Cat: PA2000-1193

Recombinant Human UBA6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBA6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UBA6;MOP4;UBE1L2;Ubiquitin-like modifier-activating enzyme 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0AVT1-3

  • Expression Region

    1-389aa

  • AA Sequence

    MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYV LGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWD LGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFG DEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREI NGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQD SEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBA6 (ubiquitin-like modifier activating enzyme 6) is a crucial protein involved in the ubiquitin-proteasome system, which regulates various cellular processes through protein degradation and modification. Emerging studies indicate that UBA6 plays a vital role in mediating the conjugation of ubiquitin-like modifiers to target proteins, thereby influencing their stability and function. The protein has garnered attention for its implications in various physiological and pathological contexts, including cancer, neurodegenerative diseases, and immune responses. Research on UBA6 has provided insights into its enzymatic activity, which is essential for the activation of ubiquitin-like proteins, such as UFM1. The dysregulation of UBA6 expression or function is linked to various diseases, suggesting that it may serve as a potential therapeutic target. Recent advancements in structural biology have enhanced our understanding of UBA6’s mechanism of action and its interactions with substrate proteins, paving the way for innovative strategies in drug development. Furthermore, studies have highlighted the significance of UBA6 in cellular stress responses and its potential role in regulating autophagy and apoptosis. Given its pivotal function in maintaining cellular homeostasis, ongoing research aims to elucidate the broader implications of UBA6 in health and disease, ultimately contributing to the establishment of novel biomolecular therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US