Analytical Data
-
Gene name
NOL12
- Application
-
Alternative Names
Nucleolar protein 12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UGY1
-
Expression Region
1-213 aa
-
AA Sequence
MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
-
Molecular Weight
51.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NOL12, a member of the nucleolar protein family, is increasingly recognized for its role in the regulation of ribosome biogenesis and cellular stress responses. Research has shown that NOL12 is involved in critical cellular processes such as pre-rRNA processing and ribosomal subunit assembly. The protein's dysregulation has been linked to various diseases, including cancer and neurological disorders, suggesting its potential as a biomarker for disease progression and therapeutic targets. Moreover, the functional characterization of NOL12 and its interactions with other nucleolar proteins are vital for understanding the intricate molecular mechanisms governing cellular homeostasis and stress adaptation. The development of recombinant NOL12 protein has enabled detailed structural and functional studies, which are essential to decipher its specific roles in the nucleolus and beyond. Through these investigations, scientists aim to unravel the complex pathways influenced by NOL12 and contribute to the broader field of molecular biology and disease research.
