Cat: PA2000-9655

Recombinant Human NEB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NEB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cleavage and polyadenylation specific factor 4; 30kDa; Cleavage and polyadenylation specificity factor 30 kDa subunit; Cleavage and polyadenylation specificity factor subunit 4; cleavage polyadenylation specificity factor; 30kD; CPSF 30 kDa subunit; CPSF30; Cpsf4; CPSF4_HUMAN; NAR; Neb-1; NEB1; No arches homolog; no arches like zinc finger protein; NS1 effector domain binding protein 1; NS1 effector domain-binding protein 1; OTTHUMP00000206235; OTTHUMP00000206237; OTTHUMP00000206239

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95639

  • Expression Region

    1-244 aa

  • AA Sequence

    MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

  • Molecular Weight

    54.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of NEB (nuclease-excised body) recombinant proteins has gained significant attention in the field of molecular biology and biotechnology due to their pivotal role in various biological processes, including DNA repair, replication, and recombination. NEB proteins, particularly those involved in the nucleic acid processing, are essential for maintaining genomic stability and facilitating cellular responses to DNA damage. Their unique enzymatic activities, such as endonuclease, exonuclease, and helicase functions, make them valuable tools for research and therapeutic applications. As recombinant DNA technology has advanced, the ability to produce NEB proteins in vitro using techniques like bacterial expression systems has allowed researchers to investigate their biochemical properties and functional mechanisms in greater detail. This research has implications not only for basic science but also for applied fields, such as gene therapy, cancer treatment, and synthetic biology, where engineered nucleases and recombinases are employed for targeted genome editing. Furthermore, NEB proteins serve as pivotal reagents in molecular cloning, next-generation sequencing, and other genomic technologies, underscoring their versatility and importance in modern biological research. Thus, understanding their structure, function, and applications remains a crucial trajectory for ongoing research, promising enhanced methodologies and innovations within the realms of genetic engineering and molecular therapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US