Cat: PA2000-1095

Recombinant Human MICAL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MICAL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MICAL2;KIAA0750;MICAL2PV1;MICAL2PV2;[F-actin]-monooxygenase MICAL2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94851

  • Expression Region

    1-495aa

  • AA Sequence

    MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFY SKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLR TAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFC AGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGW RAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGKLAIAITANFI NRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQ LPSLDFAMNHYGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSL LEPFWPMGTGCARGFLAAFDTAWMVKSWNQGTPPLELLAERESLYRLLPQ TTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYITKELEH

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MICAL2, or MICAL-like protein 2, is a member of the MICAL family of proteins that play pivotal roles in various cellular processes, including actin dynamics, cell signaling, and neurogenesis. The study of MICAL2 has gained traction due to its emerging significance in understanding neurodevelopmental disorders, cancer metastasis, and cellular response to oxidative stress. These proteins contain an FAD-binding and a calmodulin-binding domain, which are crucial for their enzymatic activity and modulation of intracellular pathways. MICAL2 has been implicated in the regulation of actin filaments, influencing cell shape and motility, crucial for processes such as neuronal growth cone dynamics. Investigating the recombinant expression of MICAL2 facilitates the elucidation of its structure-function relationships, enabling researchers to dissect its role in various biological contexts. Furthermore, understanding the molecular mechanisms through which MICAL2 operates could provide insights into therapeutic targets for conditions associated with its dysregulation. Recombination techniques also allow for the investigation of potential interaction partners and post-translational modifications, which are essential for its activity and function. This ongoing research enhances our comprehension of MICAL2's participation in fundamental cellular processes, positioning it as a significant focus in cell biology, developmental neuroscience, and cancer research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US