Cat: PA1000-2739

Recombinant Human RNF181 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RNF181

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RNF181;E3 ubiquitin-Protein ligase RNF181

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9P0P0

  • Expression Region

    1-153aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMASYFDEHDCEPSDPEQETRTNMLLEL ARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCP VCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTY EEHRRDKARKQQQQHRLENLHGAMYT

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RNF181 is a member of the RING finger E3 ubiquitin ligase family, which plays a crucial role in the ubiquitin-proteasome pathway, a vital cellular mechanism for protein degradation and regulation. The interest in RNF181 stems from its potential involvement in various biological processes, including cell cycle regulation, DNA repair, and apoptosis. Recent studies have suggested that RNF181 may be linked to pathological conditions such as cancer and neurodegenerative diseases, highlighting its significance in both normal cellular functions and disease states. The recombinant production of RNF181 is essential for studying its biochemical properties, molecular interactions, and functional roles in different cellular contexts. By generating and characterizing recombinant RNF181 protein, researchers aim to elucidate its mechanisms of action and establish its potential as a therapeutic target. Additionally, understanding the structure-function relationship of RNF181 could provide insights into its regulatory capabilities and interactions with other cellular proteins. This research is vital for advancing our knowledge of ubiquitin ligases and their contributions to cellular homeostasis and disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US