Analytical Data
-
Gene name
RND3
- Application
-
Alternative Names
RND3;ARHE;RHO8;RHOE;Rho-related GTP-binding Protein RhoE
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61587
-
Expression Region
1-241aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKERRASQKLSSKSIMDPNQNVKCKIVVVG DSQCGKTALLHVFAKDCFPENYVPTVFENYTASFEIDTQRIELSLWDTSG SPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKM LLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVA TDLRKDKAKSC
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RND3, also known as Rho family GTPase 3, is a member of the Rho family of small GTPases that play crucial roles in various cellular processes, including cytoskeletal dynamics, cell migration, and proliferation. Research has shown that RND3 is involved in both physiological and pathological contexts, such as cancer progression and neuronal development. Unlike other Rho GTPases that primarily function as molecular switches controlling cellular signaling, RND3 exhibits unique properties, including a lack of GTP binding ability, which suggests that it may regulate signaling pathways differently. The study of recombinant RND3 proteins aims to uncover their specific functions and interactions at a molecular level, particularly in the context of disease mechanisms. Utilizing recombinant techniques allows researchers to produce RND3 in a controlled environment, facilitating the investigation of its structural characteristics and functional implications. Understanding RND3's role in cellular processes is essential for determining its potential as a therapeutic target in disorders where its dysregulation is implicated. The exploration of RND3's interactions with other proteins and its upstream and downstream signaling pathways could also provide insights into novel treatment strategies for various diseases. Thus, the research on RND3 recombinant proteins is pivotal to elucidating the complex biological functions of this GTPase and fostering the development of targeted interventions in related medical fields.
