Cat: PA1000-2717

Recombinant Human RGS4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RGS4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RGS4;Regulator of G-Protein signaling 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49798

  • Expression Region

    1-205aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMCKGLAGLPASCLRSAKDMKHRLGFLLQKS DSCEHNSSHNKKDKVVIC QRVSQEEVKKWAESLENLISHECGLAAFKA FLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQA TKE VNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLD LVNPSSCGAEKQKGAKSSADCA SLVPQCA

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RGS4 (Regulator of G protein Signaling 4) is a critical member of the RGS protein family, known for its role in regulating G protein-coupled receptor (GPCR) signaling pathways. These pathways are vital for various physiological processes, including neurotransmission, cell proliferation, and cardiovascular function. Dysregulation of RGS4 has been implicated in several psychiatric disorders and cardiovascular diseases, making it an important target for therapeutic intervention. Research into RGS4 recombinant proteins has gained momentum as these proteins facilitate the study of RGS4's structure, function, and interactions with G proteins and receptors. By producing RGS4 in a recombinant form, scientists can elucidate its precise mechanisms of action, assess its functional properties, and explore its potential as a drug target. Studies utilizing RGS4 recombinant proteins have also contributed to understanding how RGS4 influences GPCR signaling dynamics and offers insights into developing novel molecules that could modulate these pathways for therapeutic benefits. In particular, the characterization of RGS4's interactions at the molecular level opens new avenues for drug discovery that may lead to more effective treatments for diseases linked to GPCR dysregulation. Overall, the investigation of RGS4 recombinant proteins is a promising field that merges basic biochemistry with clinical potential, highlighting the significance of RGS4 in both health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US