Analytical Data
-
Gene name
RGS19
- Application
-
Alternative Names
RGS19;GAIP;GNAI3IP;Regulator of G-Protein signaling 19
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49795
-
Expression Region
1-217aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPTPHEAEKQITGPEEADRPPSMSSHDTAS PAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPS PEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEA NQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGS19, also known as Regulator of G-protein Signaling 19, is a member of the RGS protein family that plays a critical role in modulating G-protein-coupled receptor (GPCR) signaling pathways. Research has shown that RGS19 acts as a GTPase-activating protein (GAP) for Gα subunits, thereby accelerating the hydrolysis of GTP to GDP and effectively terminating GPCR signaling. This regulation is crucial for maintaining cellular homeostasis and controlling various physiological processes, including cell proliferation, differentiation, and immune responses. Dysregulation of RGS19 has been implicated in several diseases, including cancer and cardiovascular disorders, making it a significant target for therapeutic interventions. The study of recombinant RGS19 protein has gained momentum, as it aids in understanding the structural and functional characteristics of this protein, along with its interactions with G-proteins and other signaling molecules. Advanced techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy are employed to elucidate the conformational dynamics and regulatory mechanisms underlying RGS19's activity. These insights not only enhance our understanding of GPCR signaling but also pave the way for the development of novel drugs aimed at modulating RGS protein functions in various pathological contexts. Overall, research on RGS19 recombinant protein continues to contribute significantly to the fields of cell biology, pharmacology, and medicine.
