Analytical Data
-
Gene name
RGS10
- Application
-
Alternative Names
RGS10;Regulator of G-Protein signaling 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43665
-
Expression Region
1-181aa
-
AA Sequence
MGSSHHHHHH SSGLVPRGSH MGSH MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPE GVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSS KASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSD LFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGS10 (Regulator of G-protein signaling 10) is a member of the RGS protein family, which plays a crucial role in modulating G-protein-coupled receptor (GPCR) signaling pathways. This regulation is vital for various physiological processes, including immune response, neuronal signaling, and cardiovascular function. Research has shown that RGS10 is particularly important in the context of inflammation and autoimmune diseases, as it can influence the activation of immune cells. The interest in RGS10 has grown due to its potential as a therapeutic target for conditions such as multiple sclerosis and other inflammatory disorders. Recombinant RGS10 protein is frequently used in research to understand its structure, function, and interaction with GPCRs and G-proteins. Studies typically involve the expression and purification of RGS10 in heterologous systems, allowing for in vitro assays that elucidate its biochemical properties. By analyzing RGS10's role in signal transduction, researchers hope to uncover novel mechanisms of action and pathways that could be exploited for drug development. The insights gained from RGS10 studies not only enhance our understanding of G-protein signaling but also pave the way for innovative approaches to modulate immune responses and treat related diseases.











