Cat: PA1000-2710

Recombinant Human RGS10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RGS10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RGS10;Regulator of G-Protein signaling 10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43665

  • Expression Region

    1-181aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSH MGSH MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPE GVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSS KASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSD LFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RGS10 (Regulator of G-protein signaling 10) is a member of the RGS protein family, which plays a crucial role in modulating G-protein-coupled receptor (GPCR) signaling pathways. This regulation is vital for various physiological processes, including immune response, neuronal signaling, and cardiovascular function. Research has shown that RGS10 is particularly important in the context of inflammation and autoimmune diseases, as it can influence the activation of immune cells. The interest in RGS10 has grown due to its potential as a therapeutic target for conditions such as multiple sclerosis and other inflammatory disorders. Recombinant RGS10 protein is frequently used in research to understand its structure, function, and interaction with GPCRs and G-proteins. Studies typically involve the expression and purification of RGS10 in heterologous systems, allowing for in vitro assays that elucidate its biochemical properties. By analyzing RGS10's role in signal transduction, researchers hope to uncover novel mechanisms of action and pathways that could be exploited for drug development. The insights gained from RGS10 studies not only enhance our understanding of G-protein signaling but also pave the way for innovative approaches to modulate immune responses and treat related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US