Cat: PA1000-2679

Recombinant Human RBM18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBM18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RBM18;Probable RNA-binding Protein 18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96H35

  • Expression Region

    1-190aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMEAETKTLPLENASILSEGSLQEGHRL WIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFE TKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPS SSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKR TTPYSRTAWKSRR

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The RBM18 (RNA Binding Motif Protein 18) is a member of the RNA-binding protein family, known to play a crucial role in various cellular processes, including mRNA splicing, stability, and translation regulation. Recent studies have highlighted its involvement in cell proliferation and differentiation, making it a significant target for understanding various biological pathways and diseases, particularly in cancer. Recombining RBM18 into a recombinant protein allows for the exploration of its functional properties and interactions with other cellular molecules in a controlled environment. The development of RBM18 recombinant protein is particularly relevant for elucidating its specific roles in RNA metabolism and protein synthesis. Given its essential functions, the study of RBM18 not only enhances our understanding of fundamental cellular mechanisms but also provides insights into potential therapeutic targets for diseases where RNA processing and regulation are disrupted. This research background underpins the importance of RBM18 in cellular biology and its potential implications in clinical settings, encouraging ongoing investigation into its structure and function.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US