Analytical Data
-
Gene name
RBM18
- Application
-
Alternative Names
RBM18;Probable RNA-binding Protein 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96H35
-
Expression Region
1-190aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEAETKTLPLENASILSEGSLQEGHRL WIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFE TKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPS SSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKR TTPYSRTAWKSRR
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The RBM18 (RNA Binding Motif Protein 18) is a member of the RNA-binding protein family, known to play a crucial role in various cellular processes, including mRNA splicing, stability, and translation regulation. Recent studies have highlighted its involvement in cell proliferation and differentiation, making it a significant target for understanding various biological pathways and diseases, particularly in cancer. Recombining RBM18 into a recombinant protein allows for the exploration of its functional properties and interactions with other cellular molecules in a controlled environment. The development of RBM18 recombinant protein is particularly relevant for elucidating its specific roles in RNA metabolism and protein synthesis. Given its essential functions, the study of RBM18 not only enhances our understanding of fundamental cellular mechanisms but also provides insights into potential therapeutic targets for diseases where RNA processing and regulation are disrupted. This research background underpins the importance of RBM18 in cellular biology and its potential implications in clinical settings, encouraging ongoing investigation into its structure and function.
