Analytical Data
-
Gene name
RBM11
- Application
-
Alternative Names
RBM11;Splicing regulator RBM11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57052
-
Expression Region
1-281aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMFPAQEEADRTVFVGNLEARVREEILY ELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIALLNGIRLYG RPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYF PINNTSLPQEYFLFQKMQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHV PDLEAGPSSYKWTHQQPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPS SYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKK KKRY
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBM11 (RNA-binding motif protein 11) is an important member of the RNA-binding protein family that has garnered significant interest in recent years due to its potential role in various biological processes and disease mechanisms. Initially identified for its involvement in modulating RNA splicing and gene expression, RBM11 has been implicated in critical cellular functions such as cell proliferation, differentiation, and apoptosis. Research has shown that RBM11 can interact with multiple RNA targets and regulatory proteins, suggesting a complex network of interactions that may influence cellular behavior. Moreover, dysregulation of RBM11 has been linked to several pathologies, including cancer, where it may contribute to tumorigenesis by altering the expression of oncogenes and tumor suppressor genes. To better understand the functional roles of RBM11 in health and disease, studies have focused on the characterization of its recombinant protein. By producing RBM11 as a recombinant protein, researchers aim to elucidate its structure, binding partners, and functional mechanisms at a molecular level. This understanding could pave the way for the development of targeted therapeutic strategies, particularly in malignancies where RBM11 is found to be overexpressed or mutated. As a result, continued exploration of RBM11 as a recombinant protein not only enhances the fundamental understanding of RNA-binding proteins but also holds promise for advancing precision medicine approaches in treating related diseases.
