Cat: PA1000-2678

Recombinant Human RBM17 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RBM17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RBM17;SPF45;Splicing factor 45

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96I25

  • Expression Region

    1-401aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLYDDLGVETSDSKTEGWSKNFKLLQSQL QVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLK DPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKE IEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTS LVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSF LANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVG DATEKDASKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEEC EKYGKVGKCVIFEIPGAPDDEAVRIFLEFERVESAIKAVVDLNGRYFGGR VVKACFYNLDKFRVLDLAEQV

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RBM17 (RNA-binding motif protein 17) is an essential splicing factor that plays a critical role in the regulation of gene expression and alternative splicing processes. Research has shown that RBM17 is involved in various cellular functions, including cell proliferation, differentiation, and apoptosis, making it significant in both normal biological processes and pathological conditions such as cancer. The protein interacts with pre-mRNA transcripts, influencing the splicing machinery's decision-making, which can result in the production of multiple protein isoforms from the same gene. Dysregulation of RBM17 has been associated with several diseases, particularly in cancer, where it can affect the expression of oncogenes and tumor suppressor genes. Given its importance in RNA processing and its potential role as a therapeutic target, researchers have focused on the structural and functional characterization of RBM17 through recombinant protein studies. These studies involve the production of RBM17 in various expression systems, allowing for the investigation of its biochemical properties, interaction partners, and functional implications in cell biology. Understanding the mechanisms by which RBM17 regulates splicing and its interactions with other cellular components is crucial for deciphering its role in health and disease, paving the way for potential therapeutic interventions targeting splicing pathways influenced by RBM17.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US