Analytical Data
-
Gene name
TNFSF18
- Application
-
Alternative Names
TNFSF18；AITRL；GITRL；TL6；Tumor necrosis factor ligand superfamily member 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNG2
-
Expression Region
50-177aa
-
AA Sequence
LFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPP CVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTL TNKSKIQNVGGTYELHVGDTIDLIFNSE
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF18, also known as tumor necrosis factor superfamily member 18, is a cytokine that plays a crucial role in immune system regulation and inflammation. Research has highlighted its significance in various biological processes, including cell proliferation, survival, and apoptosis. TNFSF18 is primarily expressed in immune cells and is known to interact with its receptor, contributing to the activation and regulation of T cells. Its involvement in inflammatory diseases and cancer has prompted investigations into its potential as a therapeutic target. Recent studies have also suggested that TNFSF18 may play a role in modulating the tumor microenvironment, influencing anti-tumor immunity. Additionally, its ability to enhance the immune response has attracted interest in developing TNFSF18-based recombinant proteins for use in immunotherapy. Understanding the molecular mechanisms underlying TNFSF18 function and its interactions with other signaling pathways could pave the way for novel treatment strategies for autoimmune diseases and malignancies. Thus, the research into TNFSF18 recombinant proteins not only holds promise for therapeutic applications but also enhances our overall understanding of immune system dynamics.
