Cat: PA2000-1039

Recombinant Human TNFSF18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFSF18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFSF18;AITRL;GITRL;TL6;Tumor necrosis factor ligand superfamily member 18

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UNG2

  • Expression Region

    50-177aa

  • AA Sequence

    LFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPP CVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTL TNKSKIQNVGGTYELHVGDTIDLIFNSE

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFSF18, also known as tumor necrosis factor superfamily member 18, is a cytokine that plays a crucial role in immune system regulation and inflammation. Research has highlighted its significance in various biological processes, including cell proliferation, survival, and apoptosis. TNFSF18 is primarily expressed in immune cells and is known to interact with its receptor, contributing to the activation and regulation of T cells. Its involvement in inflammatory diseases and cancer has prompted investigations into its potential as a therapeutic target. Recent studies have also suggested that TNFSF18 may play a role in modulating the tumor microenvironment, influencing anti-tumor immunity. Additionally, its ability to enhance the immune response has attracted interest in developing TNFSF18-based recombinant proteins for use in immunotherapy. Understanding the molecular mechanisms underlying TNFSF18 function and its interactions with other signaling pathways could pave the way for novel treatment strategies for autoimmune diseases and malignancies. Thus, the research into TNFSF18 recombinant proteins not only holds promise for therapeutic applications but also enhances our overall understanding of immune system dynamics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US