Analytical Data
-
Gene name
MYO9B
- Application
-
Alternative Names
MYO9B; MYR5; Unconventional myosin-IXb; Unconventional myosin-9b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13459
-
Expression Region
201-290 aa
-
AA Sequence
CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL
-
Molecular Weight
35.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYO9B, a member of the myosin superfamily, plays a critical role in various cellular processes, particularly in the regulation of cell morphology and motility. Its significance has been highlighted in studies linking MYO9B to key functions such as actin filament organization and cell signaling pathways. Research has shown that MYO9B is involved in the modulation of Rho GTPase activity, which is essential for controlling cellular dynamics, including cytoskeletal rearrangements and adhesion processes. Furthermore, MYO9B has been implicated in several physiological and pathological conditions, including cancer metastasis, where its expression levels are often altered. Given the importance of MYO9B in such processes, recombinant MYO9B protein has become a valuable tool for investigating its functional mechanisms in vitro and in vivo. The study of this protein enables researchers to explore its interaction partners and downstream effects on cellular behavior, offering insights into therapeutic targets for diseases where MYO9B is dysregulated. Consequently, the production and characterization of recombinant MYO9B protein is crucial for advancing our understanding of its biological roles and potential applications in biomedical research.
