Cat: PA1000-2652

Recombinant Human RALB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RALB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RALB;Ras-related Protein Ral-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11234

  • Expression Region

    1-203aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVV GNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREI RTKKMSENKDKNGKKSSKNKKSFKERC

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RALB, a member of the RAS-like small GTPase family, plays a crucial role in cell signaling, influencing various cellular processes such as proliferation, differentiation, and cytoskeletal dynamics. Recent studies have highlighted its involvement in cancer progression, particularly in the context of metastasis and tumorigenesis. RALB is activated by guanine nucleotide exchange factors (GEFs) and regulates effector proteins that mediate its downstream effects. Given its significant role in oncogenic pathways, RALB has emerged as a potential therapeutic target. The recombinant expression of RALB protein enables detailed studies of its structure, function, and interactions with other cellular components. Understanding the molecular mechanisms underlying RALB's action can provide insights into its role in cancer biology, paving the way for novel therapeutic strategies that could inhibit its activity or disrupt its signaling pathways. The development of RALB-targeting drugs could potentially lead to improved treatment options for various malignancies, underscoring the importance of ongoing research in this area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US