Analytical Data
-
Gene name
RALB
- Application
-
Alternative Names
RALB;Ras-related Protein Ral-B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11234
-
Expression Region
1-203aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAANKSKGQSSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVV GNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREI RTKKMSENKDKNGKKSSKNKKSFKERC
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RALB, a member of the RAS-like small GTPase family, plays a crucial role in cell signaling, influencing various cellular processes such as proliferation, differentiation, and cytoskeletal dynamics. Recent studies have highlighted its involvement in cancer progression, particularly in the context of metastasis and tumorigenesis. RALB is activated by guanine nucleotide exchange factors (GEFs) and regulates effector proteins that mediate its downstream effects. Given its significant role in oncogenic pathways, RALB has emerged as a potential therapeutic target. The recombinant expression of RALB protein enables detailed studies of its structure, function, and interactions with other cellular components. Understanding the molecular mechanisms underlying RALB's action can provide insights into its role in cancer biology, paving the way for novel therapeutic strategies that could inhibit its activity or disrupt its signaling pathways. The development of RALB-targeting drugs could potentially lead to improved treatment options for various malignancies, underscoring the importance of ongoing research in this area.
