Analytical Data
-
Gene name
RALA
- Application
-
Alternative Names
RALA;RAL;Ras-related Protein Ral-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11233
-
Expression Region
1-203aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMAANKPKGQNSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVG NKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIR ARKMEDSKEKNGKKKRKSLAKRIRERC
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RALA, a member of the Ras superfamily of GTPases, plays a crucial role in various cellular processes, including signal transduction, cytoskeletal dynamics, and membrane trafficking. Recent studies have highlighted its involvement in regulating cell proliferation, differentiation, and migration, making it a significant protein in cancer biology and therapeutic target development. The need to understand RALA's functional mechanisms has spurred research into its recombinant protein development, enabling detailed examination of its interactions and effects in cellular contexts. Advances in recombinant DNA technology have facilitated the production of RALA proteins, allowing scientists to investigate their structure and function more effectively. Moreover, understanding the regulatory pathways and downstream effects of RALA can uncover potential biomarkers and treatment avenues for various diseases, particularly those characterized by aberrant signaling. These efforts contribute to a broader understanding of GTPase function and its implications in health and disease, positioning RALA as a promising target for novel therapeutic strategies. As such, research into RALA recombinant proteins continues to emerge as a vital area of interest within molecular biology and biomedicine.











