Analytical Data
-
Gene name
MTL5
- Application
-
Alternative Names
Tesmin. Metallothionein-like 5. testis-specific. Testis-specific metallothionein-like protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4I5
-
Expression Region
1-306 aa
-
AA Sequence
MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAG
-
Molecular Weight
58.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTL5, a member of the metallothionein-like protein family, has garnered significant attention in recent years due to its potential roles in various biological processes and its implications in human health. Initially discovered in the context of stress responses in marine organisms, MTL5 has been linked to heavy metal detoxification and cellular defense mechanisms. Research has indicated that this protein may possess antioxidant properties and play a crucial role in mitigating oxidative stress—a key factor in many diseases, including cancer and neurodegenerative disorders. Furthermore, MTL5 is thought to participate in the regulation of metal ion homeostasis, which is vital for numerous enzymatic and biochemical reactions within the cell. As a result, understanding the structure, function, and regulatory mechanisms of MTL5 is essential for elucidating its physiological roles and potential therapeutic applications. Recent studies are focusing on the recombinant production of MTL5 to facilitate in-depth functional analyses and to explore its potential as a biomarker for disease states or a target for biomedical interventions. This ongoing research aims to unlock new insights into the protein's complex interactions within the cellular environment, ultimately advancing our comprehension of its significance in health and disease.
