Analytical Data
-
Gene name
NCOR1
- Application
-
Alternative Names
NCOR1；KIAA1047；Nuclear receptor corepressor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75376
-
Expression Region
1-373aa
-
AA Sequence
MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQRVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATI
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NCOR1 (Nuclear Receptor Co-Repressor 1) is a crucial player in the regulation of gene expression, functioning primarily as a transcriptional repressor. It plays a pivotal role in various biological processes, including development, metabolism, and cell differentiation, by interacting with nuclear receptors and other transcription factors. Dysregulation of NCOR1 has been implicated in several diseases, including cancer and metabolic disorders, making it a significant focus of research. Understanding the molecular mechanisms underlying NCOR1's function requires the production and study of recombinant NCOR1 proteins. The ability to generate NCOR1 in a controlled laboratory setting facilitates investigations into its structure, interaction with other proteins, and regulatory pathways. Recent advancements in protein expression systems and purification techniques have enabled scientists to produce high-quality NCOR1 recombinant proteins for in vitro and in vivo studies. These efforts aim to elucidate the role of NCOR1 in gene regulation and its potential as a therapeutic target. Comprehensive studies involving NCOR1 will not only enhance our knowledge of transcriptional regulation but may also lead to the development of novel strategies for treating diseases linked to its dysfunction.
