Cat: PA1000-2564

Recombinant Human PSMD11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMD11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMD11;26S proteasome non-ATPase regulatory subunit 11

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00231

  • Expression Region

    1-422aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSHMAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDE EAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVR SLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDT KRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAAL TSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCV AQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIE PFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDE PPVDKTYEAALETIQNMSKVVDSLYNKAKKLT

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMD11 is a crucial component of the 26S proteasome, which plays a vital role in protein degradation and regulation of cellular processes. The proteasome is essential for maintaining protein homeostasis by selectively degrading ubiquitinated proteins, thus influencing various cellular pathways, including cell cycle regulation, apoptosis, and signal transduction. Dysregulation of the proteasome, and specifically components like PSMD11, has been associated with numerous diseases, including cancer and neurodegenerative disorders. Recent research highlighted the importance of PSMD11 in mediating the proteasomal degradation of key regulatory proteins, which can significantly impact tumor progression and resistance to therapy. Recombining PSMD11 as a protein for functional studies allows researchers to investigate its biochemical properties, interaction dynamics within the proteasome, and its influence on substrate processing. Additionally, understanding the structure-function relationship of PSMD11 could reveal potential therapeutic targets, making it a significant focus in drug discovery efforts aimed at combating proteasome-related pathologies. The development of PSMD11 recombinant proteins thus serves both as a tool for elucidating fundamental biological mechanisms and as a potential biomarker for disease progression and treatment responses.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US