Analytical Data
-
Gene name
PSMB9
- Application
-
Alternative Names
POMP;C13orf12;UMP1;Proteasome maturation Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28065
-
Expression Region
21-219aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTTIMAVEFDGGVVMGSDSRVSA GEAVV NRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEE PPL VLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQ P FAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGV IYLVTITAAGVDHRVILGNELPKFYDE
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB9, also known as proteasome subunit beta type-9, is a crucial component of the 26S proteasome, a multi-subunit complex responsible for degrading ubiquitinated proteins, thereby regulating various cellular processes, including the cell cycle, apoptosis, and immune responses. The study of PSMB9 has gained significant attention due to its role in the generation of antigenic peptides for major histocompatibility complex (MHC) class I molecules, which are essential for cytotoxic T-cell recognition and response in adaptive immunity. Additionally, PSMB9 is implicated in various diseases, including cancer, where its expression levels can influence tumor progression and immune evasion. Researchers have focused on the recombinant production of PSMB9 to better understand its structure, function, and interaction with other proteasome subunits and inhibitors. The recombinant protein can be used in biochemical assays to study its role in proteasomal activity and its effect on antigen processing. Furthermore, the therapeutic potential of targeting PSMB9 in cancer immunotherapy and treatment of autoimmune diseases underscores the need for advanced research and characterization of this protein, which may lead to novel strategies for disease intervention and improving immune responses. Overall, the exploration of PSMB9 as a recombinant protein holds promise for enhancing our understanding of proteasome function and its implications in health and disease.
