Analytical Data
-
Gene name
PSMB8
- Application
-
Alternative Names
POMP;C13orf12;UMP1;Proteasome maturation Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28062
-
Expression Region
73-276aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMTTTLAFKFQHGVIAAVDSRASAGSY ISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERIS VSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNM FSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVN MYHMKEDGWVKVESTDVSDLLHQYREANQ
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB8, a core component of the immunoproteasome, plays a critical role in the degradation of intracellular proteins, particularly in immune responses and regulation of inflammation. It is part of the multicatalytic proteinase complex, which is essential for generating peptide fragments that are presented by major histocompatibility complex (MHC) class I molecules to CD8+ T cells, a process vital for the immune system's ability to detect and eliminate infected or cancerous cells. Given its significance in immunological processes, PSMB8 has emerged as a target of interest in studies related to autoimmune diseases, cancer, and viral infections. Dysregulation of PSMB8 has been implicated in various pathological conditions, including multiple sclerosis and certain malignancies, underscoring its potential as a biomarker and therapeutic target. The exploration of recombinant PSMB8 proteins enables researchers to delve into its biological functions, interactions, and mechanisms of action. By examining the structural and functional properties of PSMB8 through recombinant technology, scientists aim to uncover its role in immune modulation and to assess its potential in developing novel therapeutic strategies. Overall, the study of PSMB8 and its recombinant forms represents a promising avenue for enhancing our understanding of immune system regulation and for identifying new opportunities for intervention in immune-related diseases.
