Analytical Data
-
Gene name
CDY1
- Application
-
Alternative Names
CDY1；CDY1A；CDY1B；Testis-specific chromodomain Protein Y 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6F8
-
Expression Region
2-90aa
-
AA Sequence
MHHHHHHASQEFEVEAIVDKRQDKNGNTQYLVRWKGYDKQDDTWEPEQHL MNCEKCVHDFNRRQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANY
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDY1 (CDY1, chromodomain Y-like 1) is a gene located on the Y chromosome that plays a crucial role in male fertility and spermatogenesis. As a member of the chromodomain family, CDY1 is implicated in chromatin remodeling and gene regulation, particularly in the context of spermatogenic cells. Research into CDY1 has intensified due to its potential as a biomarker for male fertility disorders and its importance in understanding the mechanisms underlying spermatogenesis. The study of CDY1 recombinant proteins provides valuable insights into its functional properties, interactions with other proteins, and its involvement in cellular processes. Advances in recombinant protein technology have enabled researchers to produce CDY1 in vitro, facilitating detailed biochemical studies. These efforts aim to elucidate the molecular pathways associated with CDY1, assess its role in epigenetic regulation during sperm development, and explore its potential therapeutic applications in treating male infertility. Understanding CDY1's mechanisms of action could lead to novel strategies for diagnosing and managing reproductive issues in men, thereby contributing to the broader field of reproductive biology and medicine.
