Cat: PA2000-9477

Recombinant Human MRPS11 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MRPS11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    28S ribosomal protein S11; 28S ribosomal protein S11 mitochondrial; 28S ribosomal protein S11. mitochondrial precursor; Cervical cancer proto oncogene 2 protein; Cervical cancer proto-oncogene 2 protein; HCC 2; HCC-2; mitochondrial; Mitochondrial ribosomal protein S11; MRP S11; MRP-S11; MRPS11; RPMS11; RT11_HUMAN; S11mt

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P82912

  • Expression Region

    1-194 aa

  • AA Sequence

    MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MRPS11, or Mitochondrial Ribosomal Protein S11, is a crucial component of the mitochondrial ribosome, playing a significant role in mitochondrial protein synthesis. As a part of the 28S mitochondrial ribosomal subunit, MRPS11 is involved in the translation of mitochondrial mRNA, which encodes essential proteins for mitochondrial function. Aberrations in MRPS11 expression and function have been linked to various mitochondrial disorders and diseases, including neurodegenerative conditions and certain forms of cancer. Recent studies have focused on elucidating the precise molecular mechanisms underpinning MRPS11's role in ribosomal assembly and mitochondrial function. Additionally, the exploration of MRPS11 as a potential biomarker for mitochondrial diseases and as a target for therapeutic interventions has gained traction. Understanding the structure-function relationship of MRPS11 and its interactions with other mitochondrial ribosomal proteins is critical for developing strategies to address mitochondrial dysfunctions. Thus, research on MRPS11 not only advances our comprehension of mitochondrial biology but also opens avenues for innovative treatments for mitochondrial-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US