Cat: PA1000-2560

Recombinant Human PSMb6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMb6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMB6;LMPY;Y;Proteasome subunit beta type-6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28072

  • Expression Region

    35-239aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMTTIMAVQFDGGVVLGADSRTTTGSYIANR VTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTA ASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGG SGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI AESGVERQVLLGDQIPKFAVATLPPA

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMb6, a component of the 20S catalytic core of the proteasome, plays a critical role in the ubiquitin-proteasome system, which is essential for protein homeostasis and cellular regulation. Research has shown that PSMb6 is involved in the degradation of misfolded and damaged proteins, thus preventing their accumulation and potential toxic effects on cells. The proteasome, comprising a complex of proteolytic enzymes, is responsible for maintaining cellular function by selectively degrading proteins tagged for removal by ubiquitin. Understanding the structure and function of PSMb6 is vital for uncovering the mechanistic insights into proteasomal degradation pathways. Alterations in PSMb6 expression or function have been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Moreover, recombinant PSMb6 protein can serve as a valuable tool in biochemical assays to study proteasome activity, opening new avenues for drug discovery and the development of proteasome inhibitors. Enhanced knowledge of PSMb6 and its interactions within the proteasome may lead to innovative strategies for disease intervention and the design of novel treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US