Analytical Data
-
Gene name
PSMb6
- Application
-
Alternative Names
PSMB6;LMPY;Y;Proteasome subunit beta type-6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28072
-
Expression Region
35-239aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTTIMAVQFDGGVVLGADSRTTTGSYIANR VTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTA ASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGG SGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAI AESGVERQVLLGDQIPKFAVATLPPA
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMb6, a component of the 20S catalytic core of the proteasome, plays a critical role in the ubiquitin-proteasome system, which is essential for protein homeostasis and cellular regulation. Research has shown that PSMb6 is involved in the degradation of misfolded and damaged proteins, thus preventing their accumulation and potential toxic effects on cells. The proteasome, comprising a complex of proteolytic enzymes, is responsible for maintaining cellular function by selectively degrading proteins tagged for removal by ubiquitin. Understanding the structure and function of PSMb6 is vital for uncovering the mechanistic insights into proteasomal degradation pathways. Alterations in PSMb6 expression or function have been implicated in various diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. Moreover, recombinant PSMb6 protein can serve as a valuable tool in biochemical assays to study proteasome activity, opening new avenues for drug discovery and the development of proteasome inhibitors. Enhanced knowledge of PSMb6 and its interactions within the proteasome may lead to innovative strategies for disease intervention and the design of novel treatments.











