Analytical Data
-
Gene name
PSMB5
- Application
-
Alternative Names
POMP;C13orf12;UMP1;Proteasome maturation Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28074
-
Expression Region
60-263aa
-
AA Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMTTTLAFKFRHGVI VAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYY VDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQA TYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB5 (Proteasome Subunit Beta 5) is a vital component of the 26S proteasome, an essential cellular complex responsible for degrading ubiquitinated proteins, thus playing a crucial role in maintaining protein homeostasis, regulating the cell cycle, and modulating various signal transduction pathways. Dysregulation of PSMB5 has been associated with numerous diseases, including cancer, where it can contribute to the resistance of tumors to chemotherapy by preventing the degradation of pro-survival proteins. Research into PSMB5 has gained momentum, particularly in understanding its structure and function, which can help elucidate its role in the proteasome's catalytic mechanism. Moreover, since PSMB5 forms part of the catalytic core of the proteasome, its inhibition has become a promising therapeutic target; specifically, proteasome inhibitors have shown efficacy in treating multiple myeloma and other hematological malignancies. Consequently, recombinant PSMB5 proteins are being studied to develop novel inhibitors and to investigate their potential applications in cancer therapy and other diseases related to proteasome dysfunction. Understanding the protein’s interactions, functional dynamics, and implications in disease could pave the way for innovative treatment strategies, emphasizing the importance of ongoing research in this area.
