Analytical Data
-
Gene name
HIF1AN
- Application
-
Alternative Names
HIF1AN；FIH1；Hypoxia-inducible factor 1-alpha inhibitor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NWT6
-
Expression Region
2-349aa
-
AA Sequence
AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
-
Molecular Weight
47.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIF1AN (Hypoxia-Inducible Factor 1-Alpha Inhibitor) is a crucial regulatory protein that plays an essential role in the cellular response to hypoxia, a condition characterized by insufficient oxygen levels. Under hypoxic conditions, the stability and activity of HIF-1α, a key transcription factor, are upregulated, leading to the expression of various genes involved in cell survival, angiogenesis, and metabolic adaptation. HIF1AN functions as a negative regulator of HIF-1α, promoting its degradation and thereby modulating the hypoxic response. The study of HIF1AN and its recombinant proteins has gained significant attention due to its potential implications in various pathological conditions, including cancer, where dysregulation of the hypoxic response can contribute to tumor progression, metastasis, and resistance to therapy. Additionally, understanding HIF1AN's role in normal physiology and its interaction with other signaling pathways can provide insights into therapeutic strategies for diseases linked to oxygen deprivation, such as ischemic injuries and chronic inflammatory disorders. Advancements in recombinant protein technology allow for the production and analysis of HIF1AN, facilitating investigations into its functional mechanisms and effects on cellular processes. This research can also aid in the development of targeted therapies to manipulate the hypoxic response in various diseases, making HIF1AN a protein of considerable interest in biomedical research.
