Analytical Data
-
Gene name
PSMB4
- Application
-
Alternative Names
SMAD1;BSP1;MADH1;MADR1;Mothers against decapentaplegic homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28070
-
Expression Region
46-264aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGGVVIAADMLGS YGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGD GHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLG VAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB4, a crucial component of the 20S proteasome, plays a significant role in the ubiquitin-proteasome pathway, which is essential for protein degradation and cellular homeostasis. Research into PSMB4 has gained momentum due to its involvement in various cellular processes, including apoptosis, cell cycle regulation, and antigen presentation. Disruptions in proteasome function, often linked to diseases such as cancer and neurodegenerative disorders, have spurred interest in understanding PSMB4's structure and function. Furthermore, PSMB4 is a target of therapeutic interest, as its inhibition may enhance the efficacy of certain anti-cancer treatments. In recent years, advancements in recombinant protein technology have facilitated the production of PSMB4, allowing for detailed biochemical and biophysical studies. These investigations aim to elucidate the structural properties of PSMB4, its interactions with other proteasome subunits, and its regulation within the proteasome complex. The findings from these studies could pave the way for the development of novel therapeutic strategies, making PSMB4 a focal point in the quest for innovative treatments for proteasome-related diseases.
