Analytical Data
-
Gene name
COX7A1
- Application
-
Alternative Names
COX7A1；COX7AH；Cytochrome c oxidase subunit 7A1. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24310
-
Expression Region
1-79aa
-
AA Sequence
MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
-
Molecular Weight
9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX7A1, a vital subunit of the cytochrome c oxidase (COX) complex, plays a crucial role in the mitochondrial oxidative phosphorylation pathway, which is essential for cellular energy production. Researches have highlighted the importance of COX7A1 in various physiological processes, including cellular respiration and metabolism. Dysregulation of COX7A1 has been implicated in several diseases, such as neurodegenerative disorders, ischemic conditions, and certain cancers, underscoring its potential as a therapeutic target. Recent studies have focused on the recombinant expression of COX7A1 to better understand its structure-function relationship, facilitate the development of COX-targeted therapies, and explore its role in mitochondrial bioenergetics. Utilizing recombinant protein techniques allows for the production of large quantities of pure COX7A1, which can be used in biochemical assays, structural studies, and functional analyses. This research aims to elucidate the mechanisms by which COX7A1 contributes to cellular energy dynamics and to investigate how its manipulation might restore normal bioenergetics in pathological contexts. Ultimately, these insights could pave the way for novel interventions in diseases associated with mitochondrial dysfunction.
