Cat: PA1000-2557

Recombinant Human PSMB3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMB3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMB3;Proteasome subunit beta type-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49720

  • Expression Region

    1-246aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCVAIAADRRFGI QAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCP MVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMB3 is a crucial component of the 26S proteasome, a multi-subunit protease complex responsible for the degradation of ubiquitinated proteins within eukaryotic cells. This protein, belonging to the β-type subunit family, plays a significant role in maintaining cellular homeostasis by regulating protein turnover, which is essential for various biological processes, including cell cycle progression, immune response, and signal transduction. Dysregulation of the proteasome, particularly involving PSMB3, has been implicated in numerous diseases, including cancer, neurodegenerative disorders, and autoimmune conditions. Recent studies have focused on the potential of PSMB3 as a therapeutic target, as its inhibition can lead to the accumulation of pro-apoptotic factors in malignant cells, thereby enhancing the efficacy of existing cancer treatments. Additionally, the ability to produce and purify recombinant PSMB3 protein has opened avenues for structural and functional analyses, facilitating a better understanding of its role in the proteasome's activity and its interactions with proteasome inhibitors. These insights may contribute to the development of novel therapeutic strategies that exploit the vulnerabilities associated with altered proteasomal functions in disease states. Overall, the study of PSMB3 recombinant protein not only enhances our fundamental knowledge of proteasome biology but also holds promise for innovative approaches in targeted therapies, particularly in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US