Analytical Data
-
Gene name
PSMB3
- Application
-
Alternative Names
PSMB3;Proteasome subunit beta type-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49720
-
Expression Region
1-246aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCVAIAADRRFGI QAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCP MVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB3 is a crucial component of the 26S proteasome, a multi-subunit protease complex responsible for the degradation of ubiquitinated proteins within eukaryotic cells. This protein, belonging to the β-type subunit family, plays a significant role in maintaining cellular homeostasis by regulating protein turnover, which is essential for various biological processes, including cell cycle progression, immune response, and signal transduction. Dysregulation of the proteasome, particularly involving PSMB3, has been implicated in numerous diseases, including cancer, neurodegenerative disorders, and autoimmune conditions. Recent studies have focused on the potential of PSMB3 as a therapeutic target, as its inhibition can lead to the accumulation of pro-apoptotic factors in malignant cells, thereby enhancing the efficacy of existing cancer treatments. Additionally, the ability to produce and purify recombinant PSMB3 protein has opened avenues for structural and functional analyses, facilitating a better understanding of its role in the proteasome's activity and its interactions with proteasome inhibitors. These insights may contribute to the development of novel therapeutic strategies that exploit the vulnerabilities associated with altered proteasomal functions in disease states. Overall, the study of PSMB3 recombinant protein not only enhances our fundamental knowledge of proteasome biology but also holds promise for innovative approaches in targeted therapies, particularly in oncology.











