Analytical Data
-
Gene name
COX6c
- Application
-
Alternative Names
COX6c；Cytochrome c oxidase subunit 6C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09669
-
Expression Region
1-75aa
-
AA Sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
-
Molecular Weight
8.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX6C, a subunit of cytochrome c oxidase (CCO) complex IV in the mitochondrial respiratory chain, plays a crucial role in cellular energy production through aerobic respiration. The study of COX6C has gained importance due to its implications in various metabolic disorders and mitochondrial diseases, which are often characterized by dysfunctional oxidative phosphorylation. Recent research has focused on the expression and functional characterization of COX6C, particularly in understanding its contribution to the assembly and stability of the CCO complex. In particular, the heterogeneity in COX6C expression across different tissues suggests a potential role in tissue-specific metabolic regulation. Furthermore, mutations or alterations in COX6C have been linked to pathological conditions, highlighting the need for detailed investigations into its structure and functionality. Recombination and production of COX6C as a recombinant protein allow for in-depth studies of its biochemical properties and interactions within the CCO complex, facilitating the exploration of its role in mitochondrial function. Understanding the mechanisms governing COX6C's activity and regulation could pave the way for targeted therapies in mitochondrial-related diseases, as well as provide insights into the fundamental processes of cellular respiration.
