Analytical Data
-
Gene name
mcr-8
- Application
-
Alternative Names
mcr-8；DP2.5；Adenomatous polyposis coli Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A2U7XX87
-
Expression Region
177-565aa
-
AA Sequence
KDYASLIRNNMQIKDQALPFNFVRNTNGYLKRKYQASSTILQSVGEDAVRPIYSNAPPKLVVVVVGETARAQNFQLNGYSRVTNPYLSRRHDVISFKNVSSCGTATAISLPCMFSRMSRNEYNEVRAASEENLLDILKRTGVEVLWRNNNNGGCKGICKRVPTDDMPAMKVIGECVNKDGTCFDEVLLNQLSSRINAMQGDALIVLHQMGSHGPTYFERYPSTSKVFSPTCDSNLIEKCSNKELVNTYDNTLVYTDRMLSKTIELLQRYSGMRDVAMIYLSDHGESLGESGIYLHGTPYIIAPNEQTHIPMFMWFSSSFAQHSKLNLECLTGNADKQYSHDNFYHSILGLFNVKTSVYKPELDMFTLCRQSDHTPLSSAVVREKTDGNG
-
Molecular Weight
46.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MCR-8, a novel beta-lactamase enzyme, has emerged as a significant public health concern due to its ability to confer multidrug resistance in Gram-negative bacteria, particularly those belonging to the Enterobacteriaceae family. This enzyme is known to hydrolyze crucial antibiotics such as carbapenems, which are often considered last-resort treatments for serious infections. The research on MCR-8 is primarily driven by the increasing prevalence of antibiotic-resistant pathogens, making infections harder to treat and leading to higher morbidity and mortality rates. As MCR-8 is plasmid-borne, it can spread rapidly among bacterial populations, complicating infection control and public health efforts. Recent studies have focused on elucidating its enzymatic mechanism, genetic basis, and the epidemiology of its distribution, which are crucial for developing diagnostic tools and therapeutic strategies. Moreover, understanding the structural characteristics of MCR-8 through recombinant protein studies has paved the way for potential inhibitors that might restore the efficacy of beta-lactam antibiotics. The urgency of the situation underscores the need for continued surveillance and research into the mechanisms of resistance, as well as an exploration of novel treatment options to combat this rising tide of antibiotic resistance.
