Cat: PA2000-9419

Recombinant Human MOSPD3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MOSPD3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MOSPD3; Motile sperm domain-containing protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75425

  • Expression Region

    1-235 aa

  • AA Sequence

    MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT

  • Molecular Weight

    51.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MOSPD3 (Monsel's Protein Displacement Domain 3) is a member of the MOSPD family, which has emerged as a key player in various cellular processes, including mitochondrial dynamics and cellular stress responses. Recent studies have highlighted the importance of MOSPD3 in maintaining mitochondrial integrity and function, as it is implicated in protein transport and mitochondrial membrane stability. Understanding the role of MOSPD3 is crucial for elucidating the molecular mechanisms underlying mitochondrial-related diseases and metabolic disorders. The interest in recombinant MOSPD3 protein arises from its potential applications in biochemistry and cell biology, particularly in the development of therapeutic strategies targeting mitochondrial dysfunction. By producing and studying recombinant MOSPD3, researchers aim to investigate its structure-function relationship, interactions with other proteins, and involvement in signaling pathways. Furthermore, the development of validated assays to assess MOSPD3 activity can pave the way for high-throughput screening of small molecules that may modulate its function, ultimately leading to new treatment options for diseases associated with mitochondrial abnormalities. As research progresses, the exploration of MOSPD3's roles in health and disease will provide invaluable insights into its potential as a biomarker and therapeutic target, underscoring the significance of this recombinant protein in contemporary biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US