Analytical Data
-
Gene name
SLC25A19
- Application
-
Alternative Names
SLC25A19;DNC;MUP1;Mitochondrial thiamine pyrophosphate carrier
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HC21
-
Expression Region
1-320aa
-
AA Sequence
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR
-
Molecular Weight
37.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A19, a member of the solute carrier family, encodes a mitochondrial protein primarily involved in the transport of key metabolites across the mitochondrial membrane. Its dysfunction has been linked to a rare genetic disorder known as B phosphate transport defect (BPTD), which is characterized by neurological impairments and metabolic dysregulation. Recent studies have shown that mutations in the SLC25A19 gene lead to disruptions in mitochondrial function and energy metabolism, underscoring the importance of this protein in cellular homeostasis. Research into the recombinant form of SLC25A19 aims to elucidate its structure-function relationship and the mechanisms by which it facilitates mitochondrial transport. Producing recombinant SLC25A19 protein offers the potential to investigate its biophysical properties, interaction with other mitochondrial proteins, and the effects of specific mutations. Understanding the functional implications of SLC25A19 is crucial for developing targeted therapies for disorders associated with its dysfunction. As mitochondrial dysfunction is implicated in a range of diseases, including neurodegenerative disorders and metabolic syndromes, insights gained from studying SLC25A19 could have far-reaching implications in both basic biology and clinical applications. Thus, the exploration of SLC25A19 through recombinant protein studies represents a significant advance in our understanding of mitochondrial transport mechanisms and their impact on human health.











