Cat: PA2000-5195

Recombinant Human SLC25A19 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC25A19

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC25A19;DNC;MUP1;Mitochondrial thiamine pyrophosphate carrier

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HC21

  • Expression Region

    1-320aa

  • AA Sequence

    MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMFFSYEFFCNVFHCMNRTASQR

  • Molecular Weight

    37.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC25A19, a member of the solute carrier family, encodes a mitochondrial protein primarily involved in the transport of key metabolites across the mitochondrial membrane. Its dysfunction has been linked to a rare genetic disorder known as B phosphate transport defect (BPTD), which is characterized by neurological impairments and metabolic dysregulation. Recent studies have shown that mutations in the SLC25A19 gene lead to disruptions in mitochondrial function and energy metabolism, underscoring the importance of this protein in cellular homeostasis. Research into the recombinant form of SLC25A19 aims to elucidate its structure-function relationship and the mechanisms by which it facilitates mitochondrial transport. Producing recombinant SLC25A19 protein offers the potential to investigate its biophysical properties, interaction with other mitochondrial proteins, and the effects of specific mutations. Understanding the functional implications of SLC25A19 is crucial for developing targeted therapies for disorders associated with its dysfunction. As mitochondrial dysfunction is implicated in a range of diseases, including neurodegenerative disorders and metabolic syndromes, insights gained from studying SLC25A19 could have far-reaching implications in both basic biology and clinical applications. Thus, the exploration of SLC25A19 through recombinant protein studies represents a significant advance in our understanding of mitochondrial transport mechanisms and their impact on human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US