Analytical Data
-
Gene name
MOSPD1
- Application
-
Alternative Names
MOSPD1; Motile sperm domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJG1
-
Expression Region
1-213 aa
-
AA Sequence
MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT
-
Molecular Weight
50.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOSPD1 (MOSC domain containing 1) is a protein that has garnered attention in recent years due to its potential roles in human health and disease. Initially identified as a part of the mitochondrial outer membrane, MOSPD1 is believed to play a vital role in mitochondrial function and cellular metabolism. Studies have suggested that MOSPD1 may be involved in processes such as apoptosis, cellular signaling, and stress responses. Its expression levels appear to be altered in various pathological conditions, including cancer and neurodegenerative diseases, pointing to its potential as a biomarker for disease progression. The study of recombinant MOSPD1 proteins is critical for understanding the functional mechanisms underlying its biological roles. By producing and characterizing these proteins, researchers can investigate how MOSPD1 interacts with other cellular proteins, contributes to mitochondrial dynamics, and affects cell survival. Furthermore, the recombinant protein can be utilized in functional assays to explore its involvement in metabolic pathways and to assess its therapeutic potential. Thus, ongoing research on MOSPD1 reaffirms its significance in cellular biology, making it a compelling target for further investigation in both basic science and clinical applications.
