Cat: PA2000-5174

Recombinant Human PDCD11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDCD11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDCD11;KIAA0185;Protein RRP5 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14690

  • Expression Region

    1200-1420aa

  • AA Sequence

    GQALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSIFHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQDIKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEER

  • Molecular Weight

    25.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PDCD11, or Programmed Cell Death 11, is a critical protein involved in various cellular processes, including apoptosis and transcription regulation. This protein has garnered significant attention in cancer research due to its role in modulating the expression of key genes associated with cell survival and death. Abnormal regulation of PDCD11 has been implicated in the development and progression of several malignancies, making it a potential biomarker for cancer diagnosis and a target for therapeutic intervention. Recent studies have indicated that PDCD11 interacts with numerous cellular partners, influencing pathways related to stress responses and immune regulation. The generation of recombinant PDCD11 protein is crucial for understanding its structure-function relationship and elucidating its precise role in disease mechanisms. Research involving the production of this protein in various expression systems allows for the investigation of its biochemical properties, post-translational modifications, and interactions with other regulatory factors. Such insights can pave the way for the development of novel strategies aimed at modulating PDCD11 activity, which may lead to innovative cancer therapies or improvements in existing treatment modalities. Understanding the comprehensive dynamics of PDCD11 can ultimately enhance our ability to combat diseases linked to its dysregulation, positioning it as a valuable component in the fight against cancer.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US