Analytical Data
-
Gene name
MN1
- Application
-
Alternative Names
AA003644; AA009236; dJ353E16.2; Meningioma (disrupted in balanced translocation) 1; Meningioma (translocation balanced); Meningioma 1 ; meningioma chromosome region 1; MGCR; MGCR1; MGCR1-PEN; MN1; MN1_HUMAN; Probable tumor suppressor protein MN1; RGD1565571
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q10571
-
Expression Region
1-293 aa
-
AA Sequence
MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
-
Molecular Weight
57.97 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The MN1 recombinant protein has emerged as a subject of interest due to its pivotal role in hematopoiesis and leukaemogenesis. MN1 gene, located on chromosome 22, is known to be involved in processes critical for blood cell development and differentiation, making it an important focus in understanding various blood disorders, particularly acute myeloid leukaemia (AML). Research has indicated that the overexpression of MN1 can contribute to the transformation of hematopoietic progenitor cells, leading to malignant states. This association highlights the significance of MN1 in oncogenic signaling pathways. Consequently, scientists have been investigating MN1 as a potential therapeutic target, aiming to develop targeted treatments for leukaemia that could minimize survival-related pathways activated by MN1. Additionally, synthetic biology techniques to produce MN1 recombinant proteins have enabled detailed functional analyses, contributing to insights into its biochemical properties, interactions, and the molecular mechanisms underlying its role in disease. Understanding the expression patterns and regulatory mechanisms of MN1 not only aids in identifying biomarkers for disease prognosis but also opens avenues for innovative therapeutic strategies in the management of hematological malignancies.
