Cat: PA1000-2466

Recombinant Human PPA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PPA1;IOPPP;PP;Inorganic pyrophosphatase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15181

  • Expression Region

    1-289aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKG QYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKG KLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIG SKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVK RLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDH WKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTV PTDVDKWFHHQKN

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPA1, or inorganic pyrophosphatase 1, is a crucial enzyme that plays a significant role in cellular energy metabolism and pyrophosphate hydrolysis, which is vital for various biological processes, including nucleic acid synthesis and ATP regeneration. Its activity influences key metabolic pathways, making it a potential target for studying diseases related to energy metabolism, such as cancer and metabolic disorders. Despite its importance, the structural and functional characteristics of PPA1 remain under-explored, especially in relation to its role in pathogen interactions and potential implications in therapeutic strategies. Recent advances in recombinant protein technologies have enabled the production of PPA1 in different host systems, allowing for detailed studies of its biochemical properties and interactions with other molecules. Understanding the properties of recombinant PPA1 can lead to insights into its mechanism of action, regulation, and potential as a drug target. Furthermore, the development of PPA1 inhibitors may offer new avenues for treating diseases linked to pyrophosphate dysregulation. Thus, ongoing research into PPA1 and its recombinant variants is vital for elucidating its biological functions and exploring its therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US