Analytical Data
-
Gene name
ERV1
- Application
-
Alternative Names
ERV1；ALR；HERV1；HPO；FAD-linked sulfhydryl oxidase ALR
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27882
-
Expression Region
1-189aa
-
AA Sequence
MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLAGTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQFLNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWEKRWKDGWDE
-
Molecular Weight
22.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERV1 (Endogenous Retrovirus 1) is a critical component of the human genome, representing remnants of ancient viral infections that have been integrated into the host DNA over millions of years of evolution. Research into ERV1 recombinant proteins has gained momentum due to their potential implications in various biological processes, including immune response, gene regulation, and development of diseases. These proteins can exhibit similarity to retroviral proteins, which may facilitate insights into viral mechanisms and host-pathogen interactions. Furthermore, ERV1 proteins have been implicated in certain diseases such as cancer and autoimmune disorders, making them potential targets for diagnostic and therapeutic strategies. Studies have indicated that the expression of ERV1-derived proteins is often upregulated in specific pathological contexts, suggesting a role in inflammation and immune modulation. In recent years, advancements in molecular biology techniques have enabled scientists to produce ERV1 recombinant proteins, facilitating the exploration of their functions and interactions within the host cell environment. Understanding the biology of ERV1 proteins may not only illuminate fundamental aspects of host defense mechanisms against viruses but also contribute to the development of novel biomedical applications, including immunotherapy and vaccine design. As research continues to unravel the complexities of ERV1 and its recombinant proteins, the implications for human health and disease treatment are increasingly recognized, positioning ERV1 as a significant focus of ongoing scientific inquiry.
