Cat: PA1000-2463

Recombinant Human POU2AF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POU2AF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POU2AF1;BOB1;OBF1;POU domain class 2-associating factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16633

  • Expression Region

    1-256aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKE LLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEE AALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPS YTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSL TIDKLLLEEEDSDAYALNHTLSVEGF

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POU2AF1, also known as OBF-1, is a member of the POU (Pit-Oct-Unc) family of transcription factors, which play a crucial role in the regulation of gene expression, particularly in the immune system. It is primarily involved in the maturation of B cells and the production of immunoglobulins. The significance of studying POU2AF1 lies in its association with various hematological malignancies, notably its involvement in the pathogenesis of lymphomas. Specifically, mutations or alterations in the POU2AF1 gene have been linked to the development of diffuse large B-cell lymphoma (DLBCL). Understanding the functional mechanisms of POU2AF1 and its interaction with other transcriptional regulators can provide insights into the underlying processes of B-cell malignancies and may offer potential therapeutic targets. Additionally, the production of recombinant POU2AF1 protein allows researchers to investigate its structure-function relationships, further exploring its role in transcriptional regulation and B-cell differentiation. As a result, POU2AF1 serves as an important focal point in both basic and applied research, contributing to our understanding of immune system functions and the development of targeted therapies for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US