Analytical Data
-
Gene name
MMD
- Application
-
Alternative Names
Monocyte to macrophage differentiation factor. Progestin and adipoQ receptor family member 11. Progestin and adipoQ receptor family member XI
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15546
-
Expression Region
1-238 aa
-
AA Sequence
MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL
-
Molecular Weight
54.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMD (Molecular Mechanism of Disease) recombinant proteins have emerged as a significant focus in biomedical research due to their potential to elucidate disease mechanisms and develop novel therapeutic strategies. The increasing prevalence of various diseases, including cancer, neurodegenerative disorders, and metabolic syndromes, has driven the need for a deeper understanding of molecular pathways involved in these conditions. Recombinant proteins, produced through genetic engineering techniques, allow for the precise study of specific targets and interactions at a molecular level. This approach has revolutionized drug discovery by enabling the design of targeted therapies and biologics. Furthermore, MMD research often involves the use of advanced technologies such as CRISPR and high-throughput screening, which facilitate the identification of functionally relevant pathways and potential drug candidates. The ability to produce large quantities of pure proteins has also advanced vaccine development and the creation of biomarker-based diagnostic tools. As a result, MMD recombinant proteins are not only pivotal for basic research but also hold promise for translational applications, bridging the gap between laboratory findings and clinical solutions. Understanding their role in disease will be crucial for future innovations in patient care and personalized medicine.
