Analytical Data
-
Gene name
PIN1
- Application
-
Alternative Names
PIN1;Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13526
-
Expression Region
1-163aa
-
AA Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQG EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGE EDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPV FTDSGIHIILRTE
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIN1 (Peptidyl-prolyl isomerase NIMA-interacting 1) is a crucial enzyme that regulates the conformational dynamics of proteins by catalyzing the isomerization of proline residues in specific peptide bonds. This post-translational modification significantly influences various cellular processes, including cell cycle progression, apoptosis, and signal transduction. Research into PIN1 has gained momentum due to its implications in several diseases, particularly cancer and neurodegenerative disorders, where its overexpression is often correlated with tumorigenesis and pathological conditions. The study of recombinant PIN1 has become essential for elucidating its structural and functional properties, enabling scientists to investigate its role in protein interactions and regulatory pathways. By producing PIN1 as a recombinant protein, researchers can achieve high purity and activity levels, facilitating detailed biochemical assays, structural analyses, and the development of potential therapeutic strategies. Understanding the molecular mechanisms by which PIN1 operates offers valuable insights into its function and the development of targeted interventions in diseases where this enzyme plays a significant role. Thus, the exploration of PIN1 as a recombinant protein is a critical area of research with significant implications for biotechnology and medicine.
