Cat: PA1000-2384

Recombinant Human PHLDA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PHLDA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PHLDA2;BWR1C;HLDA2;IPL;Pleckstrin homology-like domain family A member 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q53GA4

  • Expression Region

    1-152aa

  • AA Sequence

    MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

  • Molecular Weight

    44.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PHLDA2 (Pleckstrin Homology Like Domain Family A Member 2) is a gene that encodes a protein involved in various cellular processes, particularly in the regulation of apoptosis and cell growth. Research has shown that PHLDA2 plays a crucial role in development and has been implicated in several pathological conditions, including cancer. It is believed to act as a negative regulator of cell survival, influencing the balance between cell proliferation and programmed cell death. Given its importance in these processes, PHLDA2 has emerged as a potential biomarker for certain cancers, as its expression levels can vary significantly in malignancies. The study of PHLDA2 recombinant proteins is essential for understanding its structure-function relationship and the molecular mechanisms by which it influences cellular activities. By expressing and purifying PHLDA2 as a recombinant protein, researchers can investigate its interactions with other cellular components and delineate its role in the signaling pathways related to tumorigenesis. This research not only enhances our understanding of PHLDA2's biological functions but also opens avenues for developing targeted therapies aimed at modulating its activity in disease contexts, particularly in cancer treatment strategies where apoptosis regulation is crucial.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US