Analytical Data
-
Gene name
PHLDA2
- Application
-
Alternative Names
PHLDA2;BWR1C;HLDA2;IPL;Pleckstrin homology-like domain family A member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53GA4
-
Expression Region
1-152aa
-
AA Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
-
Molecular Weight
44.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PHLDA2 (Pleckstrin Homology Like Domain Family A Member 2) is a gene that encodes a protein involved in various cellular processes, particularly in the regulation of apoptosis and cell growth. Research has shown that PHLDA2 plays a crucial role in development and has been implicated in several pathological conditions, including cancer. It is believed to act as a negative regulator of cell survival, influencing the balance between cell proliferation and programmed cell death. Given its importance in these processes, PHLDA2 has emerged as a potential biomarker for certain cancers, as its expression levels can vary significantly in malignancies. The study of PHLDA2 recombinant proteins is essential for understanding its structure-function relationship and the molecular mechanisms by which it influences cellular activities. By expressing and purifying PHLDA2 as a recombinant protein, researchers can investigate its interactions with other cellular components and delineate its role in the signaling pathways related to tumorigenesis. This research not only enhances our understanding of PHLDA2's biological functions but also opens avenues for developing targeted therapies aimed at modulating its activity in disease contexts, particularly in cancer treatment strategies where apoptosis regulation is crucial.
