Analytical Data
-
Gene name
rpsE
- Application
-
Alternative Names
rpsE；spoIIGB；RNA polymerase sigma-E factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6QJ75
-
Expression Region
1-163aa
-
AA Sequence
MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE
-
Molecular Weight
24.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RpsE, also known as ribosomal protein S5, is a crucial component of the ribosomal machinery in bacteria, playing a vital role in protein synthesis and ribosomal function. Its significance extends beyond mere structural support; RpsE is involved in the assembly of ribosomal subunits and has implications in antibiotic resistance and cellular stress responses. Studying RpsE and its recombinant protein form has garnered attention due to its potential as a target for antimicrobial drug development. Anomalies or mutations in ribosomal proteins can lead to defects in translation and protein synthesis, which in turn can initiate the development of various bacterial diseases. The ability to produce RpsE recombinantly allows researchers to investigate its structure, function, and interactions with other ribosomal components and antibiotics. Understanding these interactions at a molecular level may unveil new therapeutic strategies against resistant bacterial strains. Additionally, recombinant RpsE can serve as a model system for deciphering the complexities of bacterial ribosome functioning and its evolutionary adaptations, thus expanding our comprehension of ribosomal biology and enhancing the development of novel antimicrobial agents.
