Analytical Data
-
Gene name
bamA
- Application
-
Alternative Names
bamA；yaeT；yzzN；yzzY；Outer membrane Protein assembly factor BamA
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A940
-
Expression Region
175-424aa
-
AA Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BamA is a crucial component of the bacterial outer membrane protein assembly machinery, primarily found in Gram-negative bacteria. It plays a vital role in facilitating the proper insertion and folding of β-barrel membrane proteins, which are essential for maintaining the structural integrity and function of the bacterial outer membrane. Given its importance, BamA has become a target of interest for researchers aiming to understand the mechanisms of protein translocation and assembly, as well as its potential as a novel antibiotic target. The study of BamA and its interactions within the BAM (β-barrel assembly machinery) complex has significant implications for developing new therapeutic strategies against antibiotic-resistant bacterial infections. As the global health crisis related to multidrug-resistant bacteria intensifies, elucidating the functional dynamics of BamA could pave the way for innovative approaches in antibiotic design. Moreover, the expressible BamA recombinant protein offers a valuable platform for structural studies and can be utilized in high-throughput screenings for small molecule inhibitors, providing insights into the intricacies of outer membrane biogenesis. Overall, research on BamA not only enhances our understanding of bacterial biology but also holds promise for addressing pressing challenges in infectious disease management.
