Analytical Data
-
Gene name
PTPN13
- Application
-
Alternative Names
PTPN13;OIP1;Thyroid receptor-interacting Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12923
-
Expression Region
2169-2485aa
-
AA Sequence
DHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELE NLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFI KIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIK CQRYWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHI SHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTL ICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFCYQVILYVL TRLQAEEEQKQQPQLLK
-
Molecular Weight
61kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPN13, also known as protein tyrosine phosphatase non-receptor type 13, is a member of the protein tyrosine phosphatase (PTP) family that plays a pivotal role in various cellular processes, including proliferation, differentiation, and survival. Dysregulation of PTPs has been implicated in numerous diseases, particularly cancer, making them attractive targets for therapeutic intervention. PTPN13 is known to regulate key signaling pathways by dephosphorylating target proteins, which can alter cellular signaling cascades involved in tumorigenesis and metastasis. Recent studies have highlighted its essential role in immune response modulation and its potential as a tumor suppressor. The expression levels and functional status of PTPN13 have been associated with various malignancies, suggesting that this protein may serve as a biomarker for cancer prognosis. Furthermore, understanding the structural and functional aspects of PTPN13 through recombinant protein studies can provide insights into its mechanisms of action and enable the development of novel therapeutic strategies. Research into PTPN13 recombinant proteins has also opened avenues for the examination of post-translational modifications that impact its activity and interactions with other signaling molecules. As a result, the study of PTPN13 is not only crucial for elucidating its biological functions but also holds significant promise for the development of targeted therapies in oncology and beyond.











