Analytical Data
-
Gene name
PFDN5
- Application
-
Alternative Names
PFDN5;MM1;PFD5;Prefoldin subunit 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99471
-
Expression Region
1-154aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKNQLDQEVEFLS TSIAQLKVVQTKYVEAKD CLNVLNKSNEGKELLVPLTSSMYVPGKLHD VEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQE KHA MKQAVMEMMSQKIQQLTALGAAQATAKA
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PFDN5, or Prefoldin 5, is a pivotal protein involved in the chaperone-mediated folding of nascent polypeptides within the cellular environment. Emerging studies suggest that PFDN5 plays a critical role in the assembly and stability of protein complexes, thus contributing to various cellular functions and processes. It has been implicated in neuroprotection, where its expression is regulated by neuronal stressors, indicating its potential protective roles in neurodegenerative diseases. Moreover, PFDN5 is linked to the regulation of protein homeostasis, which is essential for cellular health and function. Recent research has also highlighted its involvement in the modulation of the immune response, pointing to its broader biological significance. Understanding the structure and function of PFDN5 through recombinant protein studies can unveil its mechanisms of action, paving the way for target-specific therapies in diseases where protein misfolding and aggregation occur. Therefore, the investigation of PFDN5 as a recombinant protein serves as a foundation for exploring its therapeutic potential and further elucidating its role in cellular dynamics and disease pathology.
