Analytical Data
-
Gene name
B3R
- Application
-
Alternative Names
B3R;KIAA1387;PP4R3B;SMEK2;Serine/threonine-Protein phosphatase 4 regulatory subunit 3B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DOP9
-
Expression Region
19-100aa
-
AA Sequence
ANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY
-
Molecular Weight
16.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The B3R protein, or the B3 domain-containing protein, has garnered significant attention in the field of molecular biology and biotechnology due to its critical role in various cellular processes, including gene regulation, plant development, and stress response mechanisms. Research indicates that B3R proteins function as transcription factors that bind to specific DNA sequences, influencing the expression of target genes essential for plant growth and adaptation to environmental challenges. This makes B3R proteins vital for understanding not just basic biological functions but also for enhancing crop resilience against climate change and biotic stressors. Recent studies have focused on the structural characterization of B3R proteins, revealing distinct motifs and domains that are crucial for their activity and specificity. Moreover, advances in genetic engineering techniques, such as CRISPR-Cas9, have opened new avenues for manipulating B3R gene expression, potentially leading to innovations in agricultural biotechnology by creating genetically modified plants with improved traits. The ongoing research on B3R proteins aims to unravel their complex regulatory networks, ultimately contributing to effective strategies for crop improvement and sustainable agriculture.











