Cat: PA2000-5075

Recombinant Human B3R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B3R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B3R;KIAA1387;PP4R3B;SMEK2;Serine/threonine-Protein phosphatase 4 regulatory subunit 3B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DOP9

  • Expression Region

    19-100aa

  • AA Sequence

    ANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY

  • Molecular Weight

    16.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The B3R protein, or the B3 domain-containing protein, has garnered significant attention in the field of molecular biology and biotechnology due to its critical role in various cellular processes, including gene regulation, plant development, and stress response mechanisms. Research indicates that B3R proteins function as transcription factors that bind to specific DNA sequences, influencing the expression of target genes essential for plant growth and adaptation to environmental challenges. This makes B3R proteins vital for understanding not just basic biological functions but also for enhancing crop resilience against climate change and biotic stressors. Recent studies have focused on the structural characterization of B3R proteins, revealing distinct motifs and domains that are crucial for their activity and specificity. Moreover, advances in genetic engineering techniques, such as CRISPR-Cas9, have opened new avenues for manipulating B3R gene expression, potentially leading to innovations in agricultural biotechnology by creating genetically modified plants with improved traits. The ongoing research on B3R proteins aims to unravel their complex regulatory networks, ultimately contributing to effective strategies for crop improvement and sustainable agriculture.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US