Analytical Data
-
Gene name
MAP1D
- Application
-
Alternative Names
METAP1D, MAP1D
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UB28
-
Expression Region
1-335aa
-
AA Sequence
MAAPSGVHLLVRRGSHRIFSSPLNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
-
Molecular Weight
63.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP1D (Microtubule-Associated Protein 1D) is a member of the MAP1 family, which plays a crucial role in the stabilization and regulation of microtubules, key components of the cytoskeleton in eukaryotic cells. Research on MAP1D has gained significance due to its potential involvement in various cellular processes including cell division, intracellular transport, and maintenance of cell shape. Given its association with neurodegenerative diseases and cancer, MAP1D is of particular interest in understanding pathological mechanisms. The study of MAP1D recombinant protein is vital for elucidating its biochemical properties and functional roles in cellular contexts. By generating and characterizing recombinant MAP1D, researchers aim to investigate its interactions with microtubules and other cytoskeletal proteins, as well as its regulatory mechanisms in cellular signaling pathways. Additionally, recombinant MAP1D serves as a valuable tool for drug discovery and therapeutic development, particularly in targeting diseases related to microtubule dysfunction. Through structural and functional analyses of MAP1D, researchers seek to uncover its specific role in cellular dynamics and the implications of its dysregulation in disease. Overall, the exploration of MAP1D recombinant protein not only enhances our understanding of cytoskeletal biology but also opens avenues for novel therapeutic strategies in treating various diseases.
