Analytical Data
-
Gene name
OTUB2
- Application
-
Alternative Names
OTUB2;C14orf137;OTB2;OTU2;Ubiquitin thioesterase OTUB2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DC9
-
Expression Region
1-234aa
-
AA Sequence
MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGN CFYRALGYSYLESLLGKSREIFKFKERVLQTPNDLLAAGFEEHKFRNFFN AFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTSAFIRNRADFF RHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMD TALNHHVFPEAATPSVYLLYKTSHYNILYAADKH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OTUB2 is a member of the ubiquitin-specific protease (USP) family, playing a critical role in protein ubiquitination and deubiquitination processes, which are essential for maintaining cellular homeostasis, regulating protein turnover, and influencing various signaling pathways. Research has shown that OTUB2 is implicated in several biological processes, including DNA repair, cell cycle regulation, and immune responses. Its ability to reverse ubiquitination marks makes it a significant player in controlling the degradation of proteins that are often involved in cancer and other diseases. Abnormal OTUB2 activity has been linked to tumorigenesis, highlighting its potential as a therapeutic target in oncology. Furthermore, understanding the structural and functional dynamics of OTUB2 can provide insights into the development of small molecules or inhibitors that modulate its activity, thereby offering novel strategies for cancer treatment and other related disorders. Thus, the recombinant production of OTUB2 protein is crucial for biophysical studies, high-throughput screening, and the exploration of its interactions with substrates and potential drug candidates, laying the groundwork for future therapeutic innovations.
