Analytical Data
-
Gene name
LYZL6
- Application
-
Alternative Names
LYZL6; LYC1; UNQ754/PRO1485Lysozyme-like protein 6; EC 3.2.1.17
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75951
-
Expression Region
1-148aa
-
AA Sequence
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LYZL6, also known as lysozyme-like protein 6, is a member of the lysozyme family, which plays a significant role in various biological processes, including innate immunity and antimicrobial defense. Emerging research has identified LYZL6 as a critical factor in reproductive biology, particularly in the male reproductive system, where it may influence sperm function and fertility. The expression of LYZL6 is particularly prominent in the testes, suggesting its essential role in spermatogenesis and sperm maturation. Recent studies have explored the potential relationships between LYZL6 and male infertility, emphasizing its importance in understanding reproductive health. Additionally, LYZL6 is being investigated for its possible biotechnological applications, including its use as a biomarker for male reproductive issues and its potential therapeutic implications in fertility treatments. As the understanding of LYZL6 continues to evolve, it holds promise for advancing our knowledge of reproductive biology and developing new strategies to address infertility and related disorders. The characterization of LYZL6 as a recombinant protein can further facilitate its functional studies, potentially leading to significant breakthroughs in reproductive health and medicine.
